IFNA8 Antibody - C-terminal region : HRP

IFNA8 Antibody - C-terminal region : HRP
SKU
AVIARP54654_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: IFNA8 is produced by macrophages, IFN-alpha have antiviral activities. It is a interferon which stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFNA8

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSINLQKRLKSKE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Interferon alpha-8

Protein Size: 189

Purification: Affinity Purified
More Information
SKU AVIARP54654_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54654_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3445
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×