Conjugation: HRP: Horseradish Peroxidase
Description of Target: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence EGLDFETAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQG
Molecular Weight: 142 kDa
Peptide Sequence: Synthetic peptide located within the following region:
EGLDFETAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQGProduct Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Intraflagellar transport protein 122 homolog
Protein Size: 1241
Purification: Affinity Purified
English
Deutsch
