Ift80 Antibody - C-terminal region : FITC

Ift80 Antibody - C-terminal region : FITC
SKU
AVIARP57456_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ift80 is a component of the intraflagellar transport (IFT) complex B, which is essential for the development and maintenance of motile and sensory cilia.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 85kDa

Peptide Sequence: Synthetic peptide located within the following region: PNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Intraflagellar transport protein 80 homolog

Protein Size: 777

Purification: Affinity Purified
More Information
SKU AVIARP57456_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57456_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 68259
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×