IGF2 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: YDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Insulin-like growth factor II Ala-25 Del Ensembl ENSP00000391826

Protein Size: 236

Purification: Affinity Purified

• SKU: AVIARP54342_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54342_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3481
• Host: Rabbit
• Conjugate: Conjugated, HRP