IGFBP2 Antibody - middle region : HRP

IGFBP2 Antibody - middle region : HRP
SKU
AVIARP54334_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IGFBP2

Key Reference: Hertel,J.K., (2008) Diabetologia 51 (6), 971-977

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Insulin-like growth factor-binding protein 2

Protein Size: 328

Purification: Affinity Purified
More Information
SKU AVIARP54334_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54334_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3485
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×