Igfbp5 Antibody - middle region : Biotin

Igfbp5 Antibody - middle region : Biotin
SKU
AVIARP54337_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: IERDSREHEEPTTSEMAEETYSPKVFRPKHTRISELKAEAVKKDRRKKLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Insulin-like growth factor binding protein 5, isoform CRA_a EMBL EDL00294.1

Protein Size: 271

Purification: Affinity Purified
More Information
SKU AVIARP54337_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54337_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 16011
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×