IL13RA2 Antibody - N-terminal region : FITC

IL13RA2 Antibody - N-terminal region : FITC
SKU
AVIARP53557_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL13RA2

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin-13 receptor subunit alpha-2

Protein Size: 380

Purification: Affinity Purified

Subunit: alpha-2
More Information
SKU AVIARP53557_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53557_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3598
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×