IL1A Antibody (HRP)

Uniprot: P01583

Gene Name: IL1A

Immunogen: Recombinant human IL1A

Purity: ≥85%

Formulation: Liquid in PBS containing 0.01% thimerosal

Identity-Mouse (%): 55%

Core Sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 55%, Rat - 59%, Pig - 67%, Cynomolgus monkey - 88%

Alternative gene names: IL1F1

Alternative protein names: Interleukin-1 alpha; IL-1 alpha; Hematopoietin-1

Protein name: Interleukin 1 alpha

Product panel: Cytokines

Clone No.: K24011_17E8

Antigen Species: Human

Target Name: IL1A

IHC Verification: -

IHC Dilution: N/A

WB Verification: -

WB Dilution: N/A

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: succeed

Sandwich ELISA Dilution: 1:250~1:500

Antigen ID: PP-064

Cross reactivity: Not tested

• SKU: ASBKH-826-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: KH-826-100
• Package Unit: 100 μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: ELISA
• Isotype: IgG1
• Human Gene ID: 3552
• Host: Mouse
• Conjugate: Conjugated, HRP