IL36B Antibody

Uniprot: Q9NZH7

Gene Name: IL36B

Immunogen: Recombinant human IL36B

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 63%

Core Sequence: REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFMGTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTNIGMPGRM

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 63%, Pig - 59%, Cynomolgus monkey - 88%

Alternative gene names: IL1F8；IL1H2

Alternative protein names: Interleukin-36 beta; FIL1 eta; Interleukin-1 eta; IL-1 eta; Interleukin-1 family member 8; IL-1F8; Interleukin-1 homolog 2; IL-1H2

Protein name: Interleukin 36 beta

Product panel: Cytokines

Clone No.: K56037_7F1

Antigen Species: Human

Target Name: IL36B

IHC Verification: -

IHC Dilution: N/A

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: P09081PAD

Cross reactivity: Not tested

• SKU: ASBKC-3794-50
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: KC-3794-50
• Package Unit: 50 μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Western Blotting
• Isotype: IgG2a
• Human Gene ID: 27177
• Host: Mouse
• Conjugate: Unconjugated