Il5 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of Il5 remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin-5

Protein Size: 133

Purification: Affinity Purified

• SKU: AVIARP54359_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54359_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 16191
• Host: Rabbit
• Conjugate: Conjugated, FITC