IMPDH1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene acts as a homotetramer to regulate cell growth. The encoded protein is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10). Several transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of IMPDH1

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: DGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inosine-5'-monophosphate dehydrogenase 1

Protein Size: 589

Purification: Affinity Purified

• SKU: AVIARP54364_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54364_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3614
• Host: Rabbit
• Conjugate: Conjugated, Biotin