IMPDH1 Antibody - middle region : Biotin

IMPDH1 Antibody - middle region : Biotin
SKU
AVIARP54363_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IMPDH1

Key Reference: Wang,J., (2008) Clin. Pharmacol. Ther. 83 (5), 711-717

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inosine-5'-monophosphate dehydrogenase 1

Protein Size: 563

Purification: Affinity Purified
More Information
SKU AVIARP54363_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54363_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 3614
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×