INPP1 Antibody - N-terminal region : Biotin

INPP1 Antibody - N-terminal region : Biotin
SKU
AVIARP54666_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes the enzyme inositol polyphosphate-1-phosphatase, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 1 of the inositol ring from the polyphosphates inositol 1,4-bisphosphate and inositol 1,3,4-trisphophosphate.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human INPP

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: EKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: inositol polyphosphate 1-phosphatase

Protein Size: 399

Purification: Affinity Purified
More Information
SKU AVIARP54666_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54666_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3628
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×