Application Note: WB: 0.1-0.5μg/ml. ICC/IF: 0.5-1μg/ml. IHC-Fr: 0.5-1μg/ml. FCM: 1-3μg/1x10⁶ cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.
Calculated MW: 54
Form: Liquid
Buffer (with preservative): 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg Sodium azide.
Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Background: This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection. [provided by RefSeq, Jul 2008]
Uniprot ID: P15260
Antigen Species: Human
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IFNGR1 (443-484aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.
Purification: Purified by antigen-affinity chromatography
Conjugation: Unconjugated
Full Name: interferon gamma receptor 1