Ippk Antibody - C-terminal region : Biotin

Ippk Antibody - C-terminal region : Biotin
SKU
AVIARP57656_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: VFYQKLLDLSTEDDGTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQGTS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inositol-pentakisphosphate 2-kinase

Protein Size: 489

Purification: Affinity Purified
More Information
SKU AVIARP57656_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57656_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 75678
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×