IQCE Antibody - middle region : Biotin

IQCE Antibody - middle region : Biotin
SKU
AVIARP55486_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: IQCE contains 2 IQ domains. The functions of IQCE remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IQCE

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: IQ domain-containing protein E

Protein Size: 695

Purification: Affinity Purified
More Information
SKU AVIARP55486_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55486_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23288
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×