Irf2bp1 Antibody - N-terminal region : Biotin

Irf2bp1 Antibody - N-terminal region : Biotin
SKU
AVIARP55314_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: ALTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon regulatory factor 2 binding protein 1 (Predicted) EMBL EDM08246.1

Protein Size: 584

Purification: Affinity Purified
More Information
SKU AVIARP55314_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55314_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 308404
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×