Uniprot: Q13568
Gene Name: IRF5
Immunogen: Recombinant human IRF5
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 77%
Core Sequence: TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQ
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 77%, Rat - 38%, Pig - 82%, Cynomolgus monkey - 86%
Alternative gene names: /
Alternative protein names: Interferon regulatory factor 5; IRF-5
Protein name: Interferon regulatory factor 5
Product panel: DNA binding & Chromatin
Clone No.: K40049_6D2
Antigen Species: Human
Target Name: IRF5
IHC Verification: -
IHC Dilution: N/A
WB Verification: -
WB Dilution: N/A
IP Verification: succeed
IP Dilution: 1:100
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: -
Sandwich ELISA Dilution: N/A
Antigen ID: PP-437
Cross reactivity: Not tested
English
Deutsch
