ISCA2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ISCA2 is involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ISCA2

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Iron-sulfur cluster assembly 2 homolog, mitochondrial

Protein Size: 154

Purification: Affinity Purified

• SKU: AVIARP53448_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53448_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 122961
• Host: Rabbit
• Conjugate: Conjugated, HRP