JAK3 Antibody - middle region : Biotin

JAK3 Antibody - middle region : Biotin
SKU
AVIARP54306_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: JAK3 is a member of the Janus kinase (JAK) family of tyrosine kinases, which is involved in cytokine receptor-mediated intracellular signal transduction. JAK3 is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in JAK3 are associated with autosomal SCID (severe combined immunodeficiency disease).The protein encoded by this gene is a member of the Janus kinase (JAK) family of tyrosine kinases involved in cytokine receptor-mediated intracellular signal transduction. It is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in this gene are associated with autosomal SCID (severe combined immunodeficiency disease). Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human JAK3

Key Reference: Cheng,H., (2008) Mol. Cell. Biol. 28 (7), 2271-2282

Molecular Weight: 125kDa

Peptide Sequence: Synthetic peptide located within the following region: KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tyrosine-protein kinase JAK3

Protein Size: 1124

Purification: Affinity Purified
More Information
SKU AVIARP54306_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54306_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3718
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×