KCTD21 Antibody - N-terminal region : Biotin

KCTD21 Antibody - N-terminal region : Biotin
SKU
AVIARP54466_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: KCTD21 contains 1 BTB (POZ) domain. The exact function of KCTD21 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD21

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: RDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: BTB/POZ domain-containing protein KCTD21

Protein Size: 260

Purification: Affinity Purified
More Information
SKU AVIARP54466_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54466_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 283219
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×