KIAA0892 Antibody - middle region : HRP

KIAA0892 Antibody - middle region : HRP
SKU
AVIARP55232_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: KIAA0892 belongs to the mau-2 family. It contains 4 TPR repeats. The function of KIAA0892 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0892

Key Reference: Seitan,V.C., PLoS Biol. 4 (8), E242 (2006)

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: MAU2 chromatid cohesion factor homolog

Protein Size: 613

Purification: Affinity Purified

Subunit: SCC4 homolog
More Information
SKU AVIARP55232_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55232_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23383
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×