KIAA0999 Antibody - middle region : Biotin

KIAA0999 Antibody - middle region : Biotin
SKU
AVIARP53784_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of KIAA0999 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0999

Molecular Weight: 139kDa

Peptide Sequence: Synthetic peptide located within the following region: LHAQQLLKRPRGPSPLVTMTPAVPAVTPVDEESSDGEPDQEAVQSSTYKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase SIK3

Protein Size: 1263

Purification: Affinity Purified
More Information
SKU AVIARP53784_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53784_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23387
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×