KIAA1191 Antibody - middle region : Biotin

KIAA1191 Antibody - middle region : Biotin
SKU
AVIARP56289_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA1191

Key Reference: Zuhlke,C., (1999) DNA Seq. 10 (1), 1-6

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: TKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative monooxygenase p33MONOX

Protein Size: 305

Purification: Affinity Purified
More Information
SKU AVIARP56289_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56289_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57179
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×