KLF8 Antibody - N-terminal region : FITC

KLF8 Antibody - N-terminal region : FITC
SKU
AVIARP57952_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: KLF8 is abnormally expressed in female patients with X autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLF8

Key Reference: Wang,X., (2007) Cancer Res. 67 (15), 7184-7193

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: LLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Krueppel-like factor 8

Protein Size: 359

Purification: Affinity Purified
More Information
SKU AVIARP57952_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57952_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 11279
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×