KRCC1 Antibody - N-terminal region : Biotin

KRCC1 Antibody - N-terminal region : Biotin
SKU
AVIARP56951_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KRCC1

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: KMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lysine-rich coiled-coil protein 1

Protein Size: 259

Purification: Affinity Purified
More Information
SKU AVIARP56951_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56951_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51315
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×