LANCL2 Antibody - middle region : FITC

LANCL2 Antibody - middle region : FITC
SKU
AVIARP57285_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LANCL2 is necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LANCL2

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: LQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LanC-like protein 2

Protein Size: 450

Purification: Affinity Purified
More Information
SKU AVIARP57285_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57285_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55915
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×