Uniprot: Q9GZY6
Gene Name: LAT2
Immunogen: Recombinant human LAT2
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 43%
Core Sequence: WGRFSKPPEDDDANSYENVLICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIHQWRESRKVMGQLQREASPGP
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 43%, Rat - 46%, Pig - 47%, Cynomolgus monkey - 88%
Alternative gene names: LAB；NTAL；WBS15；WBSCR15；WBSCR5
Alternative protein names: Linker for activation of T-cells family member 2; Linker for activation of B-cells; Membrane-associated adapter molecule; Non-T-cell activation linker; Williams-Beuren syndrome chromosomal region 15 protein; Williams-Beuren syndrome chromosomal region 5 protein
Protein name: Linker for activation of T cells family member 2
Clone No.: K52022_8E2
Antigen Species: Human
Target Name: LAT2
IHC Verification: succeed
IHC Dilution: 1:100~1:200
WB Verification: succeed
WB Dilution: 1:1000
IP Verification: succeed
IP Dilution: 1:100
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: -
Sandwich ELISA Dilution: N/A
Antigen ID: PP-971
Cross reactivity: Not tested
English
Deutsch
