Anti-LAMTOR4

late endosomal/lysosomal adaptor, MAPK and MTOR activator 4, Polyclonal, IgG, Rabbit

Sequence: MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV

GeneName: LAMTOR4

Ensembl Gene ID: ENSG00000188186

UniProt ID: Q0VGL1

Entrez Gene ID: 389541

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.05

Interspecies Mouse/Rat: ENSMUSG00000050552: 96%, ENSRNOG00000027028: 97%

Enhanced Validation: Yes

• SKU: ATLHPA020998-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA020998-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry, Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 389541
• Host: Rabbit
• Conjugate: Unconjugated