LCK Antibody - N-terminal region : HRP

LCK Antibody - N-terminal region : HRP
SKU
AVIARP54524_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: LCK is a member of the Src family of protein tyrosine kinases (PTKs). It is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. LCK localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LCK

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: ENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tyrosine-protein kinase Lck

Protein Size: 363

Purification: Affinity Purified
More Information
SKU AVIARP54524_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54524_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3932
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×