LDHC Antibody - middle region : HRP

LDHC Antibody - middle region : HRP
SKU
AVIARP53602_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LDHC

Key Reference: Sharma,P.R., (2007) Clin. Biochem. 40 (18), 1414-1419

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: L-lactate dehydrogenase C chain

Protein Size: 332

Purification: Affinity Purified
More Information
SKU AVIARP53602_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53602_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3948
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×