LIG1 Antibody - middle region : Biotin

LIG1 Antibody - middle region : Biotin
SKU
AVIARP54307_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the ATP-dependent DNA ligase protein family. The encoded protein functions in DNA replication, recombination, and the base excision repair process. Mutations in this gene that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents. Disruption of this gene may also be associated with a variety of cancers. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LIG1

Key Reference: Liang,L., (2008) Nucleic Acids Res. 36 (10), 3297-3310

Molecular Weight: 102kDa

Peptide Sequence: Synthetic peptide located within the following region: ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA ligase 1

Protein Size: 919

Purification: Affinity Purified
More Information
SKU AVIARP54307_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54307_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3978
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×