LIPT1 antibody

LIPT1 antibody
SKU
GTX04598-100
Packaging Unit
100 μl
Manufacturer
GeneTex

Availability: loading...
Price is loading...
Calculated MW: 42

Form: Liquid

Buffer (with preservative): PBS, 2% sucrose, 0.09% sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, the protein encoded by this gene transfers the lipoyl moiety to apoproteins. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 13. Read-through transcription also exists between this gene and the neighboring downstream mitochondrial ribosomal protein L30 (MRPL30) gene. [provided by RefSeq, Mar 2011]

Uniprot ID: Q9Y234

Antigen Species: Human

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LIPT1 protein: NDVYQNLAVEDWIHDHMNLEGKPILFFWQNSPSVVIGRHQNPWQECNLNL

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: lipoyltransferase 1
More Information
SKU GTX04598-100
Manufacturer GeneTex
Manufacturer SKU GTX04598-100
Package Unit 100 μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Isotype IgG
Human Gene ID 51601
Host Rabbit
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF)
×