LMOD1 Antibody - N-terminal region : Biotin

LMOD1 Antibody - N-terminal region : Biotin
SKU
AVIARP54847_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The leiomodin 1 protein (LMOD1) has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy.The leiomodin 1 protein has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LMOD1

Key Reference: Lane,H.Y., (2006) J Clin Psychopharmacol 26 (2), 128-134

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leiomodin-1

Protein Size: 600

Purification: Affinity Purified
More Information
SKU AVIARP54847_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54847_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25802
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×