LOC284009 Antibody - N-terminal region : HRP

LOC284009 Antibody - N-terminal region : HRP
SKU
AVIARP54457_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of LOC284009 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC284009

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: IRCGRPAVVHIGGEGARWEKGARGRKEHRLRRSDLGSRPVPFLAQGIPDI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Putative uncharacterized protein LOC284009 EMBL AAH93711.1

Protein Size: 157

Purification: Affinity Purified
More Information
SKU AVIARP54457_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54457_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 284009
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×