LRRC15 antibody

LRRC15 antibody
SKU
GTX04827-100
Packaging Unit
100 μl
Manufacturer
GeneTex

Availability: loading...
Price is loading...
Calculated MW: 64

Form: Liquid

Buffer (with preservative): PBS, 2% Sucrose, 0.09% Sodium Azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Uniprot ID: Q8TF66

Antigen Species: Human

Immunogen: A synthetic peptide directed towards the N terminal region of human LRRC15: LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: leucine rich repeat containing 15
More Information
SKU GTX04827-100
Manufacturer GeneTex
Manufacturer SKU GTX04827-100
Package Unit 100 μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Isotype IgG
Human Gene ID 131578
Host Rabbit
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF)
×