LRRC18 Antibody - N-terminal region : Biotin

LRRC18 Antibody - N-terminal region : Biotin
SKU
AVIARP56171_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: LRRC18 may be involved in the regulation of spermatogenesis and sperm maturation.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LRRC18

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: NLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat-containing protein 18

Protein Size: 255

Purification: Affinity Purified
More Information
SKU AVIARP56171_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56171_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 474354
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×