LRRC23 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: LRRC23 contains 5 LRR (leucine-rich) repeats. The exact function of LRRC23 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRRC23

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: ISLHTVELRGNQLESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Leucine-rich repeat-containing protein 23

Protein Size: 343

Purification: Affinity Purified

• SKU: AVIARP53487_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53487_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10233
• Host: Rabbit
• Conjugate: Conjugated, HRP