LRRC33 Antibody - N-terminal region : Biotin

LRRC33 Antibody - N-terminal region : Biotin
SKU
AVIARP55907_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC33

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat-containing protein 33

Protein Size: 692

Purification: Affinity Purified
More Information
SKU AVIARP55907_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55907_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 375387
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×