LRRC56 Antibody - N-terminal region : FITC

LRRC56 Antibody - N-terminal region : FITC
SKU
AVIARP53452_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LRRC56 contains 3 LRR (leucine-rich) repeats. The exact function of LRRC56 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC56

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat-containing protein 56

Protein Size: 542

Purification: Affinity Purified
More Information
SKU AVIARP53452_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53452_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 115399
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×