LRRC57 Antibody - N-terminal region : Biotin

LRRC57 Antibody - N-terminal region : Biotin
SKU
AVIARP55577_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of LRRC57 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC57

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat-containing protein 57

Protein Size: 239

Purification: Affinity Purified
More Information
SKU AVIARP55577_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55577_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 255252
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×