LTA4H Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LTA4H hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LTA4H

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: IVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leukotriene A-4 hydrolase

Protein Size: 611

Purification: Affinity Purified

• SKU: AVIARP54367_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54367_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4048
• Host: Rabbit
• Conjugate: Conjugated, FITC