LTA4H Antibody - N-terminal region : HRP

LTA4H Antibody - N-terminal region : HRP
SKU
AVIARP54367_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: LTA4H hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LTA4H

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: IVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Leukotriene A-4 hydrolase

Protein Size: 611

Purification: Affinity Purified
More Information
SKU AVIARP54367_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54367_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4048
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×