LTB4DH Antibody - N-terminal region : FITC

LTB4DH Antibody - N-terminal region : FITC
SKU
AVIARP54865_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LTB4DH functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. It has no activity towards PGE1, PGE2 and PGE2-alpha. LTB4DH catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LTB4DH

Key Reference: Chou,W.L., (2007) J. Biol. Chem. 282 (25), 18162-18172

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prostaglandin reductase 1

Protein Size: 329

Purification: Affinity Purified
More Information
SKU AVIARP54865_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54865_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22949
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×