LYRM1 Antibody - middle region : Biotin

LYRM1 Antibody - middle region : Biotin
SKU
AVIARP57413_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: LYRM1 may promote cell proliferation and inhibition of apoptosis of preadipocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LYRM1

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LYR motif-containing protein 1

Protein Size: 122

Purification: Affinity Purified
More Information
SKU AVIARP57413_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57413_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57149
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×