Lysozyme antibody

Lysozyme antibody
SKU
GTX03467-100
Packaging Unit
100 μg
Manufacturer
GeneTex

Availability: loading...
Price is loading...
Application Note: WB: 0.1-0.5μg/ml. ICC/IF: 5μg/ml. IHC-P: 0.5-1μg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.

Calculated MW: 17

Form: Liquid

Buffer (with preservative): 5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis. [provided by RefSeq, Oct 2014]

Uniprot ID: P61626

Antigen Species: Human

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa; NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ).

Purification: Purified by antigen-affinity chromatography

Conjugation: Unconjugated

Full Name: lysozyme
More Information
SKU GTX03467-100
Manufacturer GeneTex
Manufacturer SKU GTX03467-100
Package Unit 100 μg
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus)
Clonality Polyclonal
Application Immunofluorescence, Immunohistochemistry (paraffin), Western Blotting, Immunocytochemistry
Isotype IgG
Human Gene ID 4069
Host Rabbit
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF)
×