LYZL6 Antibody - N-terminal region : FITC

LYZL6 Antibody - N-terminal region : FITC
SKU
AVIARP53746_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LYZL6 belongs to the glycosyl hydrolase 22 family. The exact function of LYZL6 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYZL6

Key Reference: Zhang,K., (2005) Biol. Reprod. 73 (5), 1064-1071

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lysozyme-like protein 6

Protein Size: 148

Purification: Affinity Purified
More Information
SKU AVIARP53746_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53746_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57151
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×