MAGEB4 Antibody - N-terminal region : Biotin

MAGEB4 Antibody - N-terminal region : Biotin
SKU
AVIARP56340_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEB genes are clustered on chromosome Xp22-p21. This gene sequence ends in the first intron of MAGEB1, another family member. This gene is expressed in testis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEB4

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Melanoma-associated antigen B4

Protein Size: 346

Purification: Affinity Purified
More Information
SKU AVIARP56340_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56340_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4115
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×