Magee1 Antibody - C-terminal region : Biotin

Magee1 Antibody - C-terminal region : Biotin
SKU
AVIARP57492_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Melanoma-associated antigen E1

Protein Size: 724

Purification: Affinity Purified
More Information
SKU AVIARP57492_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57492_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 107528
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×