MAPK3 Antibody - middle region : Biotin

MAPK3 Antibody - middle region : Biotin
SKU
AVIARP56431_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, a

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK3

Key Reference: Seomun,Y. (2008) Biochem. Biophys. Res. Commun. 372 (1), 221-225

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: LDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitogen-activated protein kinase 3

Protein Size: 379

Purification: Affinity Purified
More Information
SKU AVIARP56431_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56431_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5595
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×